2.50 Rating by CuteStat

arubaairlines.com is 2 decades 1 year old. It is a domain having com extension. It has a global traffic rank of #2048726 in the world. This website is estimated worth of $ 720.00 and have a daily income of around $ 3.00. As no active threats were reported recently by users, arubaairlines.com is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 411
Daily Pageviews: 822

Estimated Valuation

Income Per Day: $ 3.00
Estimated Worth: $ 720.00

Search Engine Indexes

Google Indexed Pages: 151
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 2,190,000
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 2,048,726
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

104.28.23.33

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822
Aruba | Aruba Airlines

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 12
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 10
Google Adsense: Not Applicable Google Analytics: UA-113307807-1

Websites Hosted on Same IP (i.e. 104.28.23.33)

Paul Irish

- paulirish.com
310,632 $ 28,620.00


سهامداران پدیده شاندیز و پدیده کیش

- shandizstocks.ir

سایت سهامداران پدیده شاندیز و پدیده کیش به همراه آخرین اخبار درباره پروژه های شرکت پدیده شاندیز محلی مناسب برای تمام افرای که سهام پدیده شاندیز را دارند

30,640 $ 271,440.00

uevf.org: SAG Awards 2020 Film Nominations: From 'Bombshell' to 'Paras

- uevf.org

Get the Latest News, updates, publications and the newest posts from sources uevf.org. SAG Awards 2020 Film Nominations: From 'Bombshell' to 'Parasite,' These Are the Ones to Beat

Not Applicable $ 8.95

Traffic Ticket Attorneys | York & Lancaster, PA | 717 889 7100

- centralpennsylvaniatrafficlawyers.com

Fight That Traffic Ticket! Whether it is a Speeding Ticket or another violation our experienced traffic lawyers will protect your right to drive and right to work

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Thu, 12 Dec 2019 02:49:10 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Frame-Options: SAMEORIGIN
X-Powered-By: Nette Framework
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Vary: X-Requested-With,Accept-Encoding
CF-Cache-Status: DYNAMIC
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 543c620d29df95e7-SJC
Content-Encoding: gzip

Domain Information

Domain Registrar: Acens Technologies, S.L.U.
Registration Date: Oct 4, 2002, 3:07 PM 2 decades 1 year 6 months ago
Expiration Date: Oct 4, 2020, 3:07 PM 3 years 6 months 4 weeks ago
Domain Status:
clienttransferprohibited
clientupdateprohibited
clientrenewprohibited
clientdeleteprohibited

Domain Nameserver Information

Host IP Address Country
simon.ns.cloudflare.com 108.162.193.232 United States of America United States of America
alina.ns.cloudflare.com 173.245.58.61 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
arubaairlines.com A 294 IP: 104.28.22.33
arubaairlines.com A 294 IP: 104.28.23.33
arubaairlines.com NS 86400 Target: simon.ns.cloudflare.com
arubaairlines.com NS 86400 Target: alina.ns.cloudflare.com
arubaairlines.com SOA 3600 MNAME: alina.ns.cloudflare.com
RNAME: dns.cloudflare.com
Serial: 2032516853
Refresh: 10000
Retry: 2400
Expire: 604800
Minimum TTL: 3600
arubaairlines.com MX 300 Priority: 5
Target: aspmx3.l.google.com
arubaairlines.com MX 300 Priority: 1
Target: aspmx.l.google.com
arubaairlines.com MX 300 Priority: 2
Target: alt1.aspmx.l.google.com
arubaairlines.com MX 300 Priority: 3
Target: alt2.aspmx.l.google.com
arubaairlines.com MX 300 Priority: 4
Target: aspmx2.l.google.com
arubaairlines.com AAAA 300 IPV6: 2606:4700:30::681c:1721
arubaairlines.com AAAA 300 IPV6: 2606:4700:30::681c:1621

Similarly Ranked Websites

javhdx.tv | 522: Connection timed out

- javhdx.tv
2,048,727 $ 240.00

Waggers Unlimited

- waggersunlimited.com

Quality pet items at prices you can afford! Toys, personalized sweaters, collars, small animal supplies and more! Free shipping for all orders and hassle free returns!

2,048,729 $ 720.00


Home - IDTEMPLATE

- idtemplate.net

Download high quality driverlicense template psd files customize it as you wish.

2,048,733 $ 720.00

Intranet Vendirect - Connexion

- intranet.vendirect.ca
2,048,734 $ 720.00

Full WHOIS Lookup

Domain Name: ARUBAAIRLINES.COM
Registry Domain ID: 90903004_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2015-09-30T18:13:37Z
Creation Date: 2002-10-04T09:22:22Z
Registrar Registration Expiration Date: 2020-10-04T09:22:22Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization: Aruba Airlines
Registrant State/Province: Aruba
Registrant Country: AW
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=ARUBAAIRLINES.COM
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=ARUBAAIRLINES.COM
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=ARUBAAIRLINES.COM
Name Server: ALINA.NS.CLOUDFLARE.COM
Name Server: SIMON.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-12T02:00:00Z <<<

For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en

Notes:

IMPORTANT: Port43 will provide the ICANN-required minimum data set per
ICANN Temporary Specification, adopted 17 May 2018.
Visit https://whois.godaddy.com to look up contact data for domains
not covered by GDPR policy.

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.